SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007706 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T007706
Domain Number - Region: 187-270
Classification Level Classification E-value
Superfamily Bet v1-like 0.00033
Family STAR domain 0.024
Further Details:      
 
Domain Number - Region: 315-379
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000384
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007706
Sequence length 541
Comment protein Name="PYU1_T007706" Note="Protein of unknown function" AED:0.281075257561086 QI:0|-1|0|1|-1|1|1|0|541
Sequence
MKFPTTTRMIPELVLSETEQSQYVSTAEALVAHTLAQYDEYDRVYDRRVNKEQWKPVKHR
ESLTVFKERKMFRPKVMLEATYAGSASTLAASAALPVRGSVTVPTPYASSTKWSVPTLFM
VGTIVGTLDDVMYGVATFDAPSMLLKTTYTHDELVDGEILNQIHGPTGDDPFRFLGLKWI
VKGNPAVVSPIVLPRDLVFLESTGIDQLENGDRVGYHLMHSVDLPGYGPLQNSSILRGRV
SSCIVFKELENGTVDVYMKANFEPNGKVGESVAVLSAANGLIYCSRAVYCAQHKKLAWLL
RTRANHECENNNPRASKLVCATCGKPPRAYRHVSSCKLCHNPVCQHCRVTRKISFVGQGN
KEIVRHPVNFCTSCVVSTTQKSALAIAREEVLTGRWDNERETERTKKTKSNEGQSRSQSG
DTRMPADLPEEIPACAPLEWKRTMSSNSSVSESFYSASVSSQGSFDNTYSSQGSIDNSVS
MSSRDRSQRDAEPGSLEYQEQLYRRIVQLQQAAESTYQIAMSHSVAHVSSSSVGEARRSS
M
Download sequence
Identical sequences K3WRW2
PYU1_T007706

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]