SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007712 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007712
Domain Number 1 Region: 126-266
Classification Level Classification E-value
Superfamily Outer arm dynein light chain 1 1.12e-28
Family Outer arm dynein light chain 1 0.00094
Further Details:      
 
Domain Number 2 Region: 1346-1382,1414-1485
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000000000795
Family Synaptotagmin-like (S variant) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007712
Sequence length 1918
Comment protein Name="PYU1_T007712" Note="Similar to CEP110: Centriolin (Homo sapiens)" AED:0.162063574778531 QI:0|-1|0|1|-1|1|1|0|1918
Sequence
MEDDEYPSHQRSAFYDEYDDDEEELMVDPPPPSIIIPKAREPLPRGRSSGGRDDSTSSCC
SSLSPPTTASGNGTPSQTSRDPGSMSELRNDREIITMVCTSNKSPEDVDSLDLSTATKRT
RKSMKSLRALSDFVNLTQLNVSNNVIASVDGIDAFTYLEVLSMSRNHLKRIGSPLFTLTS
LRHLDLSGNFIAHIPKAIVRLELLETLNLSGNNLSVLKEVDPLGKLMNLHECNFIANPFG
KLPTYKDYVICKLPSLKKLDESAITALVRDKSRRRFSEEMFSKDTHLREAGMAHEQEQNK
LREVRSALEAENLRLKGELQVKSKLLQNKSKEWSNATGQLLQLQQEIAMLNLDRRGSTPS
TSMYADDEQRARALFPSSRFSVPSSLHRLDEDDPQRTSASFTSAPASSPNRSESSVRTAH
RGERDSKHVPTLAQDENELEFHLRQPIPSVSPMKRSVGNVNIVSPHSRFQENSRYALSRS
MITFDTDEGLFSRSPPNIENQSQRRGNYQSCSKQLIDSSCSPPEFENWSQHRDNYQSCSK
QVVDSACSPLRSRVHTPEKQSHVTQTGQEKVVVAQPQKQEQYLSAAVQPNPLGVSPVPGR
SKIFDHLRRAFSSISSPELYDEVPSMSSEVHLAEDDSIRNDMSINRSIRFPTFEDDLACP
AYEQDSYEDTYKAQLRSQKRPSHFHRQEVSRPAGSPGRLLALSSPSPSPRSKSQRFWQRQ
QEEFRQQTLGNSPRGAKSPLKCVSSTSMTDGSVDRDMLARQIQALQSCKQSLVAEIASEE
QLLHVLKEEAAAYASQMDQLHLSIQACLREAESVESSYDGSHMSPQSPQSLPSKMLRDEE
ACRAKLEFFRQKLRFAEDKEKEIEMTMVRTTKRVLQSDLQNAPFDKEIFALTHKLQQVIV
QKEEIHLEMSRLMALVRDQQRQPSQPGTANPVEHQPNRSHQMRYNYSTPTVEEMLKAEEQ
QEQLSAEHRQTVTVARKRMDELRKRHHDVLDRICVKEDLIASFVDELKDVEKELALINAF
SPSASPRLRRQRSVGLDFHSVGAASPSYATMDPIELEVTEALRSFRQSPRKCGDSNTEIN
ADDITPGDSTVVTPSPNRPSNTASQEQKSIDAAVVSSNGDSVTTSSDAVNPTGFPSELKL
KELLTAAMMDEIKKDIFERLSSQLMGVTSQATRGERGALQDQKELHDAIAAALETQMKLA
MESFHKQRQDEEKKAKQDREKDASSPPKRTRNHAASINTTSRPNKNSDHQPHGAFALDGA
RDDDISCDQLDDFVPVNATYAMKYRFVKYRSSSSSLSPPSPNGGKLSVRAVGAHRILKAC
ERLEQAEHDCKIDAVTSMEVDPMGVKKSSLKVLLMGARDLPTSHLRTKNLDPYVSLEIVY
PEYIVASSKQSSNGRGRDMGPSLSYAADESCHSSYPPFRSRTKKKSMYPVWDEEFEFTPV
LSLKGYLHVRILNDRKLSREQLVGEVRIPLRTLLHQKKTVDWFALCIAVPSASSSCTESS
GMRKSTTILRSSGGSIRLQLQLTYSRLEKYKRAVDDLVTKYFHEHNQLPPFIEPVNHVIG
RRIAHNQEQHEESDTLSHNRFVSREDADALRELQRQRQQQYDNDDGVPEVESPAKDPDLA
AIPTFESWQAAQAEAAQQARLRESNPENGNYCHGYASTGGSPQRTSADILIASHIYDSAS
LVSHGGSGSFVPRLSAERSRLLWETPPPPQETVNLEQKQQTHHPDAHRAHESARGTASVN
MLRHSFLTNQGHTRTNPPATVKVASTSTTSAVRTKGGQKTYHQSQTLNPLTRRKTTGAAS
ERPECFDDYSPYHPDFKFIDSLDLGNMDHFVKKRKVTDLYSWQSSMRGGAAVSSGMVPYS
AADTLDFNRKTDLRIFKSPGFSRRQPSTGFPERYIGLDNQTCERLKRMFGRMDGGTTG
Download sequence
Identical sequences K3WRW8
PYU1_T007712

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]