SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007718 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007718
Domain Number 1 Region: 9-93
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000288
Family F-box domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007718
Sequence length 311
Comment protein Name="PYU1_T007718" Note="Protein of unknown function" AED:0.397970464595731 QI:0|0.2|0|0.66|1|1|6|0|311
Sequence
MSGASADAITEDVVEYVIGFLSPDDLIAAMQVNVYWQSIGRKDAIWRKYIVSRWKVERPE
RLKRSCGTDDFYELYQYLDRNRYLPRGKYTTKQQIIWGKSRQEGADAWITVAHRPDCRVL
TRGATTFIQLRVVVQNTRDQPLTIDLSEIRVRMKNGYMGKVMGSEPSAAVRHDALAPALL
AVNGLDVANTAETRSVHLNIFEFAVVSINVECHGCEFEAEFLEGCSALWLPIRRNSRCAD
LTTCRCALIPDSYHRGNIRVPIVDESVIWRHYTSISGRFMVLDCRNSSEFPNASNSLFKS
PTKSIRKTSIS
Download sequence
Identical sequences K3WRX4
PYU1_T007718

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]