SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007745 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007745
Domain Number 1 Region: 11-216
Classification Level Classification E-value
Superfamily eIF4e-like 1.96e-66
Family Translation initiation factor eIF4e 0.0000109
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007745
Sequence length 223
Comment protein Name="PYU1_T007745" Note="Similar to Os01g0970400: Eukaryotic translation initiation factor 4E-1 (Oryza sativa subsp. japonica)" AED:0.12370391390714 QI:0|0.75|0.6|0.8|1|1|5|121|223
Sequence
MSAEPVTQDPQQPVEQTEEGSKQELVATIPPAVEDAATKHPLQNRWVLWYDNPKKRHSTE
SWEENLKNVYTFSTVEDFWCLYNNVLSPTKLAIGSNYHLFKEGIRPMWEDPINAKGGKWI
FTNARSRKARLDECWLHVMLSLIGETLQDEDDICGAVVSVRKAQDRIAIWSATADAEDRQ
RAIGRGFRQALVDFGKNETLKYQSHADAAASGSSFQNEVMYEA
Download sequence
Identical sequences K3WS01
PYU1_T007745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]