SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007749 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T007749
Domain Number - Region: 4-72
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0213
Family Recombinase DNA-binding domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007749
Sequence length 91
Comment protein Name="PYU1_T007749" Note="Similar to tc3a: Transposable element Tc3 transposase (Caenorhabditis elegans)" AED:0.00543478260869568 QI:0|-1|0|1|-1|0|1|0|91
Sequence
MAKGKFLTDEERDTIRSLAANGVPLRTIAAAVKRSLGACQSAVSTPAENQRQKRQGSPQS
VTEREKRQIIRSVSVGTLSAAKVKEKLQLEC
Download sequence
Identical sequences K3WS05
PYU1_T007749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]