SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007806 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007806
Domain Number 1 Region: 139-491
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 2.99e-94
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000292
Further Details:      
 
Domain Number 2 Region: 33-122
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000245
Family Anticodon-binding domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007806
Sequence length 496
Comment protein Name="PYU1_T007806" Note="Similar to asnS: Asparaginyl-tRNA synthetase (Pasteurella multocida)" AED:0.00200400801603207 QI:0|-1|0|1|-1|1|1|0|496
Sequence
MDAQVPAPAKTVAPTLFRRSRIRVKELLARGLELEGQSVTVKGWAKTLREAGAGAFAFLE
VSDGSCFASVQVVITRESTEGFEAALESGGVGASFAVVGTVVKSPAKGQVIEVKADKVEL
YGGIPDPATYPMSKKRHTLEHLRQHAHLRPRSNIHGAAMRVRNAMAFATHEFFNSRGFLY
IHTPIITESDCEGAGEMFSVTTFLSKHPDGKLPVTKEDNKIDYKADFFDRPSYLSVSGQL
NVETHCCALSDVYTFGPTFRAENSNTSRHLAEFWMVEPEIAFADLKDDIDLAEDYLKFCV
QYAIDNCADDLDFFNKNVEKGLLDRLANTIAAPFERISYTDAVNLLCEPEHLKKGKFSVK
PTWGTDLGSEHERYLTETVFKKPVVIFNYPKEFKSFYMRLNDDGKTVAAADVLVPNVGEI
IGGSAREERLDVLEQRIIESGANPEDYKWYCDLRKYGTVPHAGFGLGFERLVRFVTGIEN
IRDVIPFPRWPGNAAF
Download sequence
Identical sequences K3WS62
PYU1_T007806

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]