SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007826 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007826
Domain Number 1 Region: 20-206
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.1e-51
Family ETFP subunits 0.00000738
Further Details:      
 
Domain Number 2 Region: 209-329
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 1.31e-48
Family C-terminal domain of the electron transfer flavoprotein alpha subunit 0.0000036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007826
Sequence length 329
Comment protein Name="PYU1_T007826" Note="Similar to etfA: Electron transfer flavoprotein subunit alpha (Pseudomonas aeruginosa)" AED:0.0106060606060606 QI:0|0|0|0.5|1|1|2|0|329
Sequence
MLARQIQRRVATFASSRSLSTLVVAEHNQKDVTGGTLSAVTAATKIGGDVTVLVLGSQAA
GIADQAAKIAGVSSVLHAADAKYDHLIAEEVTELLVAAQKEKNFTHILAPSSNASKNYLP
RVGAKLDVAPISDILAVADKDTFLRPTYAGNAIAQIKSKDAVKLITVRPTGFEKAATEGG
SASVSPAPEAATVGKTQFVSEEVSKSDRPDLTSARVVVSGGRGLKSGENFEMLYKLADKL
NGAVGASRAAVDAGYVPNELQVGQTGKVVAPELYIAAGISGAIQHLAGMKDSKTIVAINK
DEEAPIFQVSDYGLVADLFTAVPELTEKI
Download sequence
Identical sequences K3WS82
PYU1_T007826

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]