SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007894 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007894
Domain Number 1 Region: 7-67
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000217
Family Canonical RBD 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007894
Sequence length 70
Comment protein Name="PYU1_T007894" Note="Similar to NGR1: Negative growth regulatory protein NGR1 (Saccharomyces cerevisiae)" AED:1 QI:0|0|0|0|1|1|3|0|70
Sequence
MASEKGATSLALSGLAPSVTESLVTNMFRTYGPILRVSVDGSGGGHVVFAKKANAYRALP
ATNGAVLAQC
Download sequence
Identical sequences K3WSF0
PYU1_T007894

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]