SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007940 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007940
Domain Number 1 Region: 219-303
Classification Level Classification E-value
Superfamily Cyclin-like 1.07e-16
Family Transcription factor IIB (TFIIB), core domain 0.0018
Further Details:      
 
Domain Number 2 Region: 7-53
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.00000000000000623
Family Transcriptional factor domain 0.0053
Further Details:      
 
Domain Number 3 Region: 125-214
Classification Level Classification E-value
Superfamily Cyclin-like 0.0000000000000243
Family Transcription factor IIB (TFIIB), core domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007940
Sequence length 314
Comment protein Name="PYU1_T007940" Note="Similar to ttb-1: Transcription initiation factor IIB (Caenorhabditis elegans)" AED:0.154145177173568 QI:0|-1|0|1|-1|1|1|0|314
Sequence
MSECLESQCSHCGSTDVVTDFSAGDVVCRDCGMILGERIIDDTPEWRNFANDDRGGDPAA
KSRVGEVADQRLNEVSLTTYLVDPRAGKTSVSATNGGTEGGGGRAHKRPNITSECAKVKR
MKRSMDRVHEVADTMTLPKIIVETALDIYAEAEKKGISMRGPEKESMPVAVLFIACRKLG
NARSLKEFEEASGVPKKRIGKSFMTLNRSLDIEMTQPTTEEYVRRFCSRLGLPFKTQSIA
NNVAKKADTLGLSTGKSPITVAASVIYLVAAYTDAKRSIQEISTVTMIGEKNMKVVCKEL
NKSRVMLFEGVLTT
Download sequence
Identical sequences K3WSJ6
PYU1_T007940

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]