SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T007996 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T007996
Domain Number 1 Region: 8-164
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.71e-37
Family Ankyrin repeat 0.00027
Further Details:      
 
Domain Number 2 Region: 210-259
Classification Level Classification E-value
Superfamily F-box domain 0.0000000000392
Family F-box domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T007996
Sequence length 277
Comment protein Name="PYU1_T007996" Note="Similar to PSMD10: 26S proteasome non-ATPase regulatory subunit 10 (Homo sapiens)" AED:0.317751016578042 QI:0|0|0|0.33|1|1|3|0|277
Sequence
MHQAEDTTTVQLTRMLRSADAKLSHELLIASEKGKKHAAYLLLHQGIDKERCKGMSGYTP
LHYGATRGHLEVIQLLLDFGWPIDTRNDALETPLHLAAFNGHTAVAECLLDRGATINACN
EDNETPLFYAARKHHHRVVRLLIRRECDLGLQNRFGDTAQDEAANEKTLMEFAVGNEDAQ
RLYSLKRATHLTQPHWNDDNRSSSETLLAQKLRERVLMFLDLKSLCLASQVAYRWHRAAD
NPTLWRKLGVSRWELLLNATMGMGTHPESKAIELRPW
Download sequence
Identical sequences K3WSQ2
PYU1_T007996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]