SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008024 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T008024
Domain Number - Region: 13-83
Classification Level Classification E-value
Superfamily Cyclin-like 0.0068
Family Transcription factor IIB (TFIIB), core domain 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008024
Sequence length 125
Comment protein Name="PYU1_T008024" Note="Protein of unknown function" AED:0.198564593301435 QI:0|-1|0|1|-1|1|1|0|125
Sequence
MDVGVLAGLYGGIPARVVERAKEYMRVTAARKSARVDLTTPVACLLVAGKSMEETLDQKR
LSSLAGVSHRLVEQNMRKILNAVDVRSIVQTTPAALCIRFGCEAITELVNRVYAEYQVTV
QHERL
Download sequence
Identical sequences K3WST0
PYU1_T008024

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]