SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008035 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008035
Domain Number 1 Region: 232-325
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.48e-21
Family Canonical RBD 0.0034
Further Details:      
 
Domain Number 2 Region: 129-218
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.3e-21
Family Canonical RBD 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008035
Sequence length 362
Comment protein Name="PYU1_T008035" Note="Similar to gar2: Protein gar2 (Schizosaccharomyces pombe)" AED:0.0385674931129476 QI:0|-1|0|1|-1|1|1|0|362
Sequence
MAKSKAVAAAANSSGKKRSRDATEDKPPKAAAVVKDESSASSSENDDSESDDDSDSETEN
TLFRPAPVTRNESDGSSSEEESSSSEDEEEEEEEEDTPVKEEAAPVKKPTDKKAKPAADV
SDVNVESNIQEEMDKKTEATVYVEGIPYQADEGDVVSHFSVCGIVKEVRMPRYQDSGRPR
GYAHVVFESEKAIPKALALDGKYLFKRYLSVSRAQTPRTLELALKETKNVKKAVVGCKTV
FVKQLPYDIEEQALRDALASCGTIMSVRLPIWNHTKKLKGFGYVEFSKEEEAVAAVKRSG
MKVGGRMVIINLDVAGAPKASFRQTDGQYWNKTEEAKKSLAKKLSEKQQRSGATNKKRKT
TK
Download sequence
Identical sequences K3WSU1
PYU1_T008035

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]