SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008051 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008051
Domain Number 1 Region: 502-538
Classification Level Classification E-value
Superfamily Leucine zipper domain 0.0000209
Family Leucine zipper domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008051
Sequence length 739
Comment protein Name="PYU1_T008051" Note="Similar to DDB_G0271670: Uncharacterized protein DDB_G0271670 (Dictyostelium discoideum)" AED:0.144849322165616 QI:0|0|0|0.5|1|1|4|0|739
Sequence
MSKAPKAKKSQLHYQPYQSASAGEHNGLEFSAAEMPLHMDPVLTGLSSNLSRNLWDDWNE
SDGNFPMKFDMFHEDTAAQASNGGGGGTPSHHQQQQRSGSASHTPSPHAHGNGHVSHAQQ
QRPQQQRQQQQNGHMNVNMMNSGMMIPPSAYDVMSGFVGHTLLRPSSAQSNDSNGGDTSS
SSTDQLLDQPRANYRRSLSEDIVNMLDENNELMFSNTASATLTAIPAPSTAGNSDQIATP
PAGSTPTKAAAAAAAAFTSAFMFPGPLSSDVSDPKQNGKKATSSSPNGSTTASESSSDAG
STMSSNGTGSSGANGNNMANPMVTAVPGGPFGSQGMMMPGFMMYSMPMMGNYQANAMGMM
PMGMQMPMGMGMQMGAMGPMSMQMPMGMGMQMPMGMQMPMGMSMGGLPMGSMGMQMPMAL
QVNSQNGVGDANARNGAENMEITPATPSGNGGGPSLLKPAARALQPKGGDPRGPGFVSIA
RKPEEPEVSSILKSLMDEEAKKKEKKLERNRDSARESRKKQQTYVETLETGIKRLQINRD
LVAAYRWGVTGPGFGPLPCPNSPQMYDWKTRISIVTGDSEAFSNIQNPTSFNALMRMNRQ
RRALSLSHHERERAVWKCFITIGRRLAALRTRVLEAQVLRTFSQNPLAAELSEALNLTAD
QKLQLQCHAQRVFDEEVVTMVKLFKVFFALRTEAMRLNILSPSLEHFFRDACSLEQLQKL
LQWTETHRNVIEEVLPFEA
Download sequence
Identical sequences K3WSV7
PYU1_T008051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]