SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008061 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008061
Domain Number 1 Region: 66-154
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.04e-21
Family Cold shock DNA-binding domain-like 0.00093
Further Details:      
 
Domain Number 2 Region: 6-46
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.000000000254
Family ECR1 N-terminal domain-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008061
Sequence length 166
Comment protein Name="PYU1_T008061" Note="Similar to EXOSC1: 3'-5' exoribonuclease CSL4 homolog (Homo sapiens)" AED:0.0568862275449102 QI:0|-1|0|1|-1|1|1|0|166
Sequence
MNSSSVAVPGQRLAPHAQHRAGHGTYVRDGAIYASILGHYSIVQSEVRVERPGKTVGSAQ
VLRLQDEVICKVTKVTSRQVLVDIISVNGIALQESFPGTIRLEDVRNHDIDKLMMEDVFS
PGMLVKALVLSFGDTRSYFLSTAKAGLGIVRASQQQENGSIDMETN
Download sequence
Identical sequences K3WSW7
PYU1_T008061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]