SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008076 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008076
Domain Number 1 Region: 185-263
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 3.03e-20
Family Eukaryotic type KH-domain (KH-domain type I) 0.00048
Further Details:      
 
Domain Number 2 Region: 89-189
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 5.63e-18
Family Cold shock DNA-binding domain-like 0.00048
Further Details:      
 
Domain Number 3 Region: 32-89
Classification Level Classification E-value
Superfamily Ribosomal L27 protein-like 0.00000000000565
Family ECR1 N-terminal domain-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008076
Sequence length 268
Comment protein Name="PYU1_T008076" Note="Similar to exosc3: Putative exosome complex exonuclease rrp40 (Dictyostelium discoideum)" AED:0.24712060239116 QI:0|1|0.5|1|1|1|4|0|268
Sequence
MATKRKATSDAVDDATKFLEEAQRAVDFTFSPTVVLPGDDVTGVLTKTSRRIKLGAGLRQ
LPDERIVCTNAGILRYRPSNRYWVEHNYKRYVAAMDDGVIGVVTDRNAELYRVNIGAASS
VTLGALAFDGATKRNRPSLRIGSLVYARVSKTNRDLEPEISCEAPANLTKKDWMTGLAIY
GELNDGYVFKTSIGLAKRLLQEDCQVLAALGKSIPFEIAIGVNGVVWINSKSNKNTTIIS
NAIQNSETMSPSEIDVMVARLVDEAEDL
Download sequence
Identical sequences K3WSY2
PYU1_T008076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]