SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008112 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008112
Domain Number 1 Region: 1696-2052,2080-2090
Classification Level Classification E-value
Superfamily Cysteine proteinases 5.69e-75
Family Ubiquitin carboxyl-terminal hydrolase, UCH 0.0000691
Further Details:      
 
Weak hits

Sequence:  PYU1_T008112
Domain Number - Region: 970-1017
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00138
Family Ubiquitin-related 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008112
Sequence length 2366
Comment protein Name="PYU1_T008112" Note="Similar to USP9X: Probable ubiquitin carboxyl-terminal hydrolase FAF-X (Homo sapiens)" AED:0.092533269068416 QI:0|0|0|1|0|0.5|2|0|2366
Sequence
MWNVGMKDLQQAREDFDQYFYDLGNHETYLPRHLIPFVERSLLCMFFSNEMAEEMNAFHQ
HVLKNLVASLLSNDAPVPPSTDPVVVHLLSLLRMILNGHNSCMFFYIKYPGVYSAAKYQK
LVYTSYLASPDVLLTIPPRHPSRSFYFVDNVDLFFQAGGFCVILQRLAQRDIALQEVSLF
CSMLSQAKPCLAQQKRRRSSAGKRKSTSTIDSQVEDFFRDFLNATFARLRRMNNEELKDD
EGLIDHIVGMLDMLYRDGVLLGGSSGSSADSESDDYTGSDSSAVCDPFFAEAMEVFHLDL
SKKFICCPFLAQRLLGISRLNDLIAMAQRKEELQKKTTLGMRRTSSSVSSGNYSNVGFTS
SSIENQPASKWLRVKYVVEWLSTSDVLEVIMGEKEACSKYDLQEGTHLEILKRSKKIYEF
VASNGLLNENHVVLLWKTSMNQLRSGRKTVLDMLLSLCGMISADLTDVVMVLLTQVPLAE
YDELCIQFVKRVIMIAAKQVVEIEATGTKKTLGSLVGVSAGSKLSSSAQKDVEVLNKVVG
LGCCLLWNAILDGHEGESTSESTSSLKPAMRTEVESALAVSLNYIQKLWVAANSSSASSK
EQQKLLNEYIKKCAGNIKNGFLVETSMSLIQRIAEGYGSDAGSFSASSSAGLSLPRAASF
GTSSRSASPSDLLKELNSRHEIILLVVEEIKNYMKHSREKADWNSHRRSMRRRLSFLGYI
VTRSEVELSYSLIEQVWRCFNGLENTLDEREVFFEWFTGIVPDSSSFVHRAYSGNSAFSN
SVTTEIYQSLIKKRSPLERNDPRISLDVEGMGKHAFWSFERLFRFINTSERLISSGTGAG
NAQRGTSLSTPNRDEAKEAFVVESLDLKGLETLYEVALCAGNEGVSEEAINYLIYLHLHV
GSKLVRREVWTEFVNGCFDRLKKKVSSGVETERIREVHRLLVLLGTFLFQSVVQTNQILR
SGGALGDRPEELIVHVRTQDGRSAAPFRYQLRRTSLVGDLRDRIAQDTGHPADRIRILNE
FKTKLTAQGHDKFTLEKARIFTSGVSFPSALPSTAKVSSASAVVNDSQAKRVNYVEAIML
SKVESDTAGHVQRSIRERSGTLAASNTGVENDWQTLKADISSNGEWLELLFKLLTLQDEI
CEEAWKVLKLLASDIKMEKCVRTLNDTLAIDGSIRNFPASFDWKLILDPTCPPKLLYQLE
LVEHFALCGDGQPEDTHEDGDQGPAKELSKGVDGMIGTVNRWSTSFLKLGGKKHLENFLL
ACSPKLLITRGTLSVMCLSKLLKILRHFVLVELRLAEEVGGTLDGNPEELIHELLEALAS
LQDQEEAACEEAKLNAAASQAHDESETTSRITAYARPELEDPDNYFGLPSEVYLMTRALS
FISTSAIAATQDALPLLESYPGHGQIFLNCLVKSRFKPVRQESANAVAALSTTRNKSEHD
RIACCHFFLEMLSKYDGPVCDEEYYNAFTLLVSSADTLGEFAILPSCRILCRRVKEFPAS
DDHVVPRRGSSAASLSDASNQMHSSQDSQSSDSLLEALLSTLLTILKRIPPVLAGRLDVP
YRGRSLREVVSSTLHTEEGIIDELFHRCLFATPNKGQGDQDETISPSQSSSSQYYLQKPK
CRSDSSRDVAFELLTELSQENTTGLRYLLEQMSRQHSLRAPPVPKTSVSSMAPASKRKLG
KSAKEAATRNQIQERGKYVGLKNLGCTCYMNSTMQAFFMIPRFRRQILRFNAEQNSGTST
ASGEGKSVLYELQSLFAHLEGTAKSYYNPRPFTSALKTWDGESIDVNLQQDASEFLTSFF
QQIESEMNGMGDGSGDENILNTFFGGVFSNELVAEGDRYSERAEPFHFISVPVRDRKTLK
ESLDGWVEGEKVSYTWEAKAENGQDSDGAAGEKVTLDTHKRISISKLPDQLIIHLKRFEF
DFERMQQIKLHDRFEFPMELDMYPYTKQGQEEKRKRSSSSASNTGASDEASDGASEGSKS
SARDGRSTAPEYSQYELVGTVVHMGTANSGHYYSFLREQNGGNDYNQWYEFNDTVVSAFN
PQQIPDECFGGEETRRLGVSRTSSASSAASVSSSPTRMKTRSSFMLIYARKQPKLQLVPS
LSDVSRDSDSSGQISNYSTGFAAAALALTFCGKLKQKARFRLEKLRSVAQVIAPEPIRNL
IAMENRLFWRKKYLYDSRCLNFTFDVIKSCLVGSNSGSNSTSELPRFEPTEARLEALQMA
TKFVFGTLWQGGDVAKVLKWKPALLALYHTEFDGCYWLLSTLRGNEQLLLDLLVFNEHTE
VRELLASVLSEAIATTSNLEFEEEAKKSSGDSRAQPEGGDGGSKKLPASFEFIFFLFQLM
PALLSVPVEQHSQYFMTIWDFSFDAS
Download sequence
Identical sequences K3WT18
PYU1_T008112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]