SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008127 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008127
Domain Number 1 Region: 648-790,821-896,933-1034
Classification Level Classification E-value
Superfamily SAICAR synthase-like 5.49e-66
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0001
Further Details:      
 
Domain Number 2 Region: 220-441
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000119
Family Rhodopsin-like 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008127
Sequence length 1176
Comment protein Name="PYU1_T008127" Note="Similar to its3: Phosphatidylinositol-4-phosphate 5-kinase its3 (Schizosaccharomyces pombe)" AED:0.0761500380384382 QI:0|-1|0|1|-1|1|1|0|1176
Sequence
MKRPSDGSPLEARRRLGSDDSSAAHPLHASTLSLDDNVQNHPRTDSNESSGGSARPPSVI
MMRQSSHSSSQGLNTNNATGKRNFSTRAKKSRPESGSSAASSTFDPRGSVLSRLSSTAGA
NLRDTFFGGATKRHDPLELSTNQEFDLTVIDESGGMEENIVGQILSPDVGLGSGPWSGAG
YLVVGIGFVTLVVCATLAVSIKKLDGYDLEPGLVFGSFQTLLLCTIVFVTYNGVQSFQAH
PNPLILYKCVIDMILALRFLLDPLLQTWNVYTRDDPSSCKYLSGVTQFLYLASDSWYFAL
IVDLYTSLTNPFTSVKADRTKYKIAIYAVSTFSGLMTAVIPQLHGISDGSYCWTDRGGKD
GERNFWRLNTANWLLFYAWMIVYYLSGIAVLTFGAKRLRSGLRDTLQTRRDMLRNGAISI
MSFTAYWTIVFTWYAVSFHTRTHYEAQNENRISPKIRPSKIFNAFSYSLTGRGAVDYFVW
FMLNQPSLMKANWLRFSTESADKKFSAQLNTALQHELIYFTIEGMTRALQMADEELLYSR
DRSPTQGLELGGNDDDERYRKSSTPPVLGDPRESQQSVASAATGINLQDLGTESSKKKSN
RKYTNDEGATFEIPQRTTSPTSKSAAKNVKNPSAPVSPALRSPAKMASKSSYNHIRFTPY
QPEAFAELRSAYGITAQDFVKSFETSTKPNISEGASGAFMFFSGDKRFIVKSMAEAECRF
LCEIAEDYVEYLVAHPSSLITKFFGCFKITMYEKKFYFVVMENLFDVAEQGVQIHHRFDI
KGSWVNRSYKRPRKGAKVKCRHCSMQFKYGAKKVLLQCPNVVGLHEPNVVLKDNDLRTRM
RIGRQAGKELYELLRDDSLFLCSLGIMDYSLLLGVVDIEFMVDQPTGHKTGRRNTVTSNP
DGKNESFMTTDSLSSHDNGDDQEIGTVNPLSSLVHGNDDRARIDSSDDPLGHSVRSLADH
AHQPRAKKTMRRSKRIFGPGYYYVGVIDILQTWTLQKKLERFWKVNFQRCDADGLSAIDP
VQYQKRFEAKLREIIALPKEYVAGLGKRRFTAHSFGGAAMGESHRGTTSRFISSRDAASS
MLERGGAGTVYGAETKYDDGNDDDMEVGGHRSTPQLAELESSSTSHTNSSGEDLEDLEQA
NRNPEPILLHFSQMLVGSSQRSNLTALSSAHGRDTA
Download sequence
Identical sequences K3WT33
PYU1_T008127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]