SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008155 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008155
Domain Number 1 Region: 78-167,328-448,998-1207
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.57e-42
Family Calcium ATPase, transmembrane domain M 0.016
Further Details:      
 
Domain Number 2 Region: 442-466,725-830,913-993
Classification Level Classification E-value
Superfamily HAD-like 1.78e-30
Family Predicted hydrolases Cof 0.071
Further Details:      
 
Domain Number 3 Region: 460-476,580-786
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 8.18e-20
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0078
Further Details:      
 
Domain Number 4 Region: 168-235,286-326
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.0000000000000131
Family Calcium ATPase, transduction domain A 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008155
Sequence length 1317
Comment protein Name="PYU1_T008155" Note="Similar to ALA3: Phospholipid-transporting ATPase 3 (Arabidopsis thaliana)" AED:0.0632760927885878 QI:0|1|0.5|1|1|0.75|4|0|1317
Sequence
MAMEQQAAERGAHGTAKTAQGTGTSEGAVKTTARAPPEAVAQAKVATTAATCHVPHQAEP
RVAFLNEPIRNQELTVSKRYAKNVIVTSKYTTVSFVPKTLFELFRVTANVYFLVISLLQL
LTTWSPTNRFTTAGPLVFVLLVTMIKQGSEDMKRHQADEHRNNRTCRIVNEHGTTQTIAW
QELQVGQIVCVHNNEELPADIVILATSEEEGRCFIETCNLDGETNLKRRIAVKSTSMVAG
RRELNAPVLDEAPVCATAITLKGTLEYEQPNNQLYTFTGRLHLQNDGSTTPLGPESIMLR
GCGLRSCAFVLGVVIFTGSETKLLQNSRSAPSKQSKLYKTANRCMGLIFVTMFSLCLVSA
IAAAVWSHANDHRMWYLPFVKSSDANEFVKDFFTFLILFNNLVPISLYVSLDIIKVMQAK
SITSDDDMMCDAGFRAIARTSELNEELGQIEYIFSDKTGTLTCNVMEFRKCSIGGQSYGF
GTTEIGRAVAALQPEKGAERASQTTMTEVGVMLSTELNNSSASDVRERTAPIFVNESTTQ
ISQASPEGDPKLAQVHYDSSISFDDPSLLRHLNAGGPRSELIHEFLTLLAICHTVIPEVD
KKTGVVTYRASSPDEEALVKAAKCLGYNFVDPAPLTKIEVTRKNMDSGRIEPIMPISQQY
TILNVNEFNSSRKRMSIVAVNASTGEYVLYCKGADNMMLPRAVQGEYTASIQQHLRVFAG
EGLRTLVLAKRVLTREEYDAFNEEYIAASTSLQNREEQLDAVAEMIETNMQILGVTAIED
KLQENVPSTIFDLAQAGIKIWVLTGDREETAVNIGHACRLINDRMKLLYVNQESVEGLEQ
QVKELYQAPFIQQLLRTGTVSDEIAMVCDGKALVHVFPSKDALAKMSDDARERANLLAIK
LLSVASVCKALIACRVSPSQKAEIVNLVRSRSLSLPSNARKTPPITLAIGDGANDVSMIQ
TAHVGVGICGKEGVQAVNASDYAISQFKFLKRLVLIHGRSNYKRICKVIRYSFYKNIALV
ISLFLFDFCNGQSGAPLFESFVMAGWNFFLATPIIVIGVFDQDMPDAIVLKFSKLYRAGQ
CDSDLNLTVFARTIANAVFHACICFGVCYGCYNPNHGLFQMGTLFYTMLLTTMSWKVMLL
TLNWNKYHVLLLGFSVWLFVFFLIVYPLLTFLSFDMFGVPTHMLRDDLFWYLLLMCPIAA
ILLDFAILTLQQQFVPTPQDILRERYRMNASMRFSGKADIVPDNMPSLPPCSSSAAKTTS
HTKRLGGIDNALVFPTDDIWPQASSLSLLSSQIDMSRNHSSAYMKLLEAFELRQSVG
Download sequence
Identical sequences K3WT61
PYU1_T008155

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]