SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008187 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008187
Domain Number 1 Region: 33-69,306-415,815-1048
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.09e-64
Family Calcium ATPase, transmembrane domain M 0.006
Further Details:      
 
Domain Number 2 Region: 419-439,595-869
Classification Level Classification E-value
Superfamily HAD-like 1.44e-46
Family Meta-cation ATPase, catalytic domain P 0.00042
Further Details:      
 
Domain Number 3 Region: 427-656
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 6.76e-42
Family Metal cation-transporting ATPase, ATP-binding domain N 0.004
Further Details:      
 
Domain Number 4 Region: 71-174
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.0000000000275
Family Calcium ATPase, transduction domain A 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008187
Sequence length 1069
Comment protein Name="PYU1_T008187" Note="Similar to ATP2B1: Plasma membrane calcium-transporting ATPase 1 (Sus scrofa)" AED:0.0831775700934579 QI:0|0|0|0.5|1|0.5|2|0|1069
Sequence
MKQPPISMSILRRALVIVWKERTNAWWPVEVIANILCVLAVIFSIALLTARMEAHNAKLS
QPLHGMKEESHMVQVLLDGTCTEIPRRDLVVGDIVLLDGNSANDSIPVDGIAFDIQRKGL
HVGGSALSRKERGNGIVTFTHGNTALLLAGSKVVSGAAKMLVLCVGEHSQHGQSLTLARR
DDASAAEELLDHLFQGDRKISHKGHGEEEEDSDDDTASTMCSKSESSVVFETSDDRDACQ
AAQLPNLRLEHLSISIEDDNDHHTLTTYAAVSTPKPQHQQKSPVDRFRDRDDAAALKEDA
TTDIHDEQRDNASPLRFQLDHLKSNIQYIGIAIAVVLYVLMHILFLRTLEYQVSSDLFTV
ISFLNVFFSAASVLTVLTPEGLPLAVTMALTHSGKQMLRESNLLVRHLDACATVGNVTTI
CCDKTGTLTTNSMQVARVWVYGGDRASTKNNDLGTTPNCFLSAQSMCDGVSSHVKTNFCE
GIAINSTAELLFGPSQQTVFSCSDFGNKTECALLAFVRDCGIDYRAIRGAATIGRMLTFS
SEKKRMSVVVQSPEDKSKCRIYTKGAAKAVLSLCSRIQLVDGSVSDLSGSNLSCTSAVTT
IIDQFASQGYRTICLAYRDVEGLSMDAVSQWSDDDLEHDLTCLSIVGIENPVRPDVPGAV
DELKRADVVVRMVTGDNVLTACSIARQCGILPSHSEDANEVQDAVLDGPTFRLRVLDSRG
NLVQSEFDKIWPQLRVLARSSPQDKYHLVQGLKQTQLVDKLVAMAGDGTSDAPALKEAHV
GFAMGVCGTSIAKEASDIILVDDNFYSVVSAIKWGRNVYDSIGRFLQFQLTVVTLLCEVA
CMDAVFVDQPSLSTLQVLWVNWIMVCFAALALMMESPSPSLMERKPYPRSQSLVSRTMAK
HITCQALFQFTLLVLLSFYGDVWFGFAPKRTRTILDPPPGAIWRMVFEEDEDIKKHHTTI
VFNAFAWMQLFNLLNCRRIHDERNVLLSRQPWGKSKLFVCVWLFLIVVQVLLVEFGGELF
YCMPLSWTEWLACIGLGALTLPFGFILRRDFGWLGLKGALRCETPSSQP
Download sequence
Identical sequences K3WT93
PYU1_T008187

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]