SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008210 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T008210
Domain Number - Region: 87-159
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 0.0012
Family Calcium ATPase, transduction domain A 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008210
Sequence length 194
Comment protein Name="PYU1_T008210" Note="Similar to Atp8a2: Probable phospholipid-transporting ATPase IB (Mus musculus)" AED:0.228296955569683 QI:0|0|0|0.75|1|1|4|0|194
Sequence
MEALDDVRRALRQLEPRFALLNDPIRNRMLVAEEEYASNAVATSNYTAATFVILTLYELF
RIPTNAFFLLIAFIQADELQNNRPYRSERLSWQELLIGQIVRVHNNRELSAEIVILATSE
EEGRRFTDTCNLDDDTGLKRRVAMQSIANIAGWRKMNAPALVESTVCAAASTLKGRFKYE
QPSSELYEFTGHGS
Download sequence
Identical sequences K3WTB6
PYU1_T008210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]