SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008214 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008214
Domain Number 1 Region: 444-548,672-771,1221-1399
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.96e-29
Family Calcium ATPase, transmembrane domain M 0.021
Further Details:      
 
Domain Number 2 Region: 1014-1077,1123-1217
Classification Level Classification E-value
Superfamily HAD-like 5.44e-25
Family Meta-cation ATPase, catalytic domain P 0.0096
Further Details:      
 
Domain Number 3 Region: 552-674
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 1.09e-20
Family Calcium ATPase, transduction domain A 0.0013
Further Details:      
 
Domain Number 4 Region: 895-971,1010-1031
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 0.000000000000262
Family Metal cation-transporting ATPase, ATP-binding domain N 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008214
Sequence length 1473
Comment protein Name="PYU1_T008214" Note="Similar to SPCC1672.11c: Probable cation-transporting ATPase C1672.11c (Schizosaccharomyces pombe)" AED:0.0265262653322355 QI:0|-1|0|1|-1|1|1|0|1473
Sequence
MDQSAYPACAVNHKPEYYCCEYTNAAGATERELFTKFSKPQGGKYTEFYTDGWKKARQVN
FPSSQYTPDSPNFDYNVPESVCRIQRVVRVDGTLQDTLQCGIQTKIGNSYDGAIVVNASV
ADNSRDATVFWTSRTNLRNNNATFPIGVTCTNLMTEPGVVDTAAKKACVSAPTAVEPRFT
TFTEAPLMVVFVFYAVLAALLLLWWPLRSTLAMIWDVSAMHNNNHKNKSTWSTGTTGIAS
KEPVNGGLKYVDDPNVLAIPMLTHRSSDVELRAAADAIEQTGYQDAVVGKVVFAYFVFAT
LVLVPLMVVLIVDSNSHFSPPLFDPANTLIKVYIVFWVFMAAWLTLLVGFYDRMPNFFRV
KQPLDRCQYVHLFNPEASEILMSDRSGISACVRKLQSLVLPRTRRGYKQTLLVQFTEDGH
RYVEFQHLRYIYDELYGKFMPGSLPFPETFAQIREQQRDGLYELEYTRRLAIVGQNTIAV
PLPSWTHSVANEVFQFFYVYQVMCYAVWYFNGYWQVAIVNMIIIVVVMGINIVSKRKLLA
AVLQMTRTHGGVAVQRDGVWQTIKASQLVPGDLVRVAENWDVPCDLVLLKGNVLCDESAL
TGESMPVQKFAIPTTSREVYDPEDQGGKKYTLFAGAKTLFSGKRGFADAQKNDEILAVVH
ATGALTVRGQLIQSILYPAKVRFKYDEHLKAFIFVLLVFGIVSAAIAMRFLIDNAGISNS
LFAFVFGAFMLSAVVNPLIPVVVTIGQVNGMKRLQRRGIFCLNPERIALCGKVRVFAFDK
TGTITKEGLDYRGCLPVQLTSERRSNSSQSSSTSMPPVPRFSAELSDVSSAELNPLMKFA
LASCHAVGYMDDKLVGNEVELKMFAATNWKLIEEQVMDDLGQEEIRTIVESPNGDNALEL
LKRFEFDHHRMCMSVIVQDLQTNRRFVFCKGAYEKIQELATPETMPSEYMTQAERLAHEG
CYVIGIAYKEIPATADLAFGKPNADRDSDDDSSDDPEQAELLQQQQQVVREDMESGLTLL
GLVLFQNELKPDSTSVLSTLKDGGVRSVMITGDNAMTGCYIARSCGMVPSGVRVILGDIL
AINKQGGKALVWKDIDTLEILSNKDVHKMVDSSSNVGETAVELAVTGPAFNYLGKMSELS
KFLFHIRIFSRMTPVEKADCIAEMMTAGAVTGMCGDGGNDCGALRIAHVGVALSDSEASV
VSPFTSQKKSIAAVVDVCREGRCTLSTTFGNLKFLIIYGLIGCGLRFTMYSNAVFVAKYS
FVFNDGLVLVGLSYAITLAKPAATLGSERPTSSLIGVTTLLSILGQVAIHVVFLYTSVHM
LMTQAWYCPFNPDDVDLSKGWLLEDTALSTTLFLVISPQFMISAVSFGFGARYHQPVYRN
VFLMLYFCALFGFLLYLALGAPSRVTEAFRIATSTNVVGLPDIPLPHSFQSSLMVRVVIN
MAAILVFEFLVVTGPLRKWIRAKCHNDQLNLRL
Download sequence
Identical sequences K3WTC0
PYU1_T008214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]