SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008280 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008280
Domain Number 1 Region: 4-91
Classification Level Classification E-value
Superfamily BRCT domain 1.16e-18
Family DNA topoisomerase II binding protein 1, TopBP1 0.034
Further Details:      
 
Domain Number 2 Region: 92-189
Classification Level Classification E-value
Superfamily BRCT domain 7.41e-18
Family DNA ligase 0.04
Further Details:      
 
Domain Number 3 Region: 495-623
Classification Level Classification E-value
Superfamily BRCT domain 1.83e-17
Family DNA ligase 0.02
Further Details:      
 
Domain Number 4 Region: 225-327
Classification Level Classification E-value
Superfamily BRCT domain 0.0000000000093
Family DNA topoisomerase II binding protein 1, TopBP1 0.01
Further Details:      
 
Weak hits

Sequence:  PYU1_T008280
Domain Number - Region: 399-523
Classification Level Classification E-value
Superfamily BRCT domain 0.0252
Family DNA-repair protein XRCC1 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008280
Sequence length 654
Comment protein Name="PYU1_T008280" Note="Similar to Topbp1: DNA topoisomerase II-binding protein 1 (Mus musculus)" AED:0.0377458896065765 QI:0|0|0|0.66|1|1|3|0|654
Sequence
MSEKLFDGLWICTTGLEVHVKEQIRKIVLACGGTFDDDLALDSTTHLIADAVGSQKHRAA
EAHNIHVATPKWVFDSFRAHTLLDIASYRLRILEGLVICTTGLASHSRDQVERMATIHGA
LYDPNLEVGHTSVLIAQRPGGAKYEASVSFNIPIVHISWLHACLENETLLDESEFSLEKV
LRPSRLFSQLQEEINQVVTALPQLMKRYHEQHKQDDDWNPQDDDDDVEWMDLFDSCIFHL
IGFPSNVEAQLQQLIRTSMGTIYYDMSTAHVTHVLVSPSLRDGHALASLEEQVSMAHAET
HVHFVSAKWLLDSIKCLRLEPEEMYPVEIDADHEMPPTAPSVPSMYETALDASYEHIPDA
IECAATIAAAAQDDGAPPAPDAPQDDADDIPQGNKPQSLFSGCAFLLLCRDPDDRLLIKP
LIKQIHHQSQAQAFAVDFRDLAHLDTSQFTFLTHIVICDGVDVEPDVAMQIDQQFASLKD
VDKHDNNDQKKRKRRRGVTFVSDLWVHCCLAAQVMLSHQAHELFSLTVHQTRSLFSHPLP
LRCFTKVRASTSVYVGVDRVVVMELLKLAGAQATSKMSKRNSHLICLKPIGMKYEKAKEW
GLKIVTARWLIQSIIQGTLLDEQADEFQVKDEDDGNGDADEAAADVNGGDQAGE
Download sequence
Identical sequences K3WTI6
PYU1_T008280

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]