SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008299 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008299
Domain Number 1 Region: 212-404,447-561
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 2.83e-55
Family Diacylglycerol kinase-like 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008299
Sequence length 564
Comment protein Name="PYU1_T008299" Note="Similar to Sphk2: Sphingosine kinase 2 (Mus musculus)" AED:0.0811775761422899 QI:0|0|0|1|1|1|2|0|564
Sequence
MDVTPGPSSSSSGDDSTRNSAAAPTRHETDADLHSLLARLQLHFVHRSPKRMWLGRPMRV
TFELALTHLRLHMQHEIDEPKKSKEKHHAKRLHRELLWQDVLGAHILTHDGEHLDRDQIN
AALASDAAKTKSYLLGVFACPAMAKRAAQGAPDAWLKKRRLFEAFYQFQGAQLQDVVALR
RWINYLADPRTASLLAKTASIVALTPEELPARKFLVIINPVGGAGKGVQTYESKVAPIFK
YAGIDTTVEVTEHAGHATEIVTSMPLQHYDCVLPVGGDGSLSEITQGLMKRPDWNCAIRQ
PIGIIPSGSGNGLSHSILHECQERGKPINAAFVLAKGAAQELDITSVRNGKETMYSFLSL
EWASIADVDVISEKFRALGGLRFGLVYAHHILFSKKEYPGSLWYLEDDLATSQHEPSRYF
ETHSPESTEYPPLDLIDEENKANLGGTWKEVKGPFRLVWVMGITHAASDAIVAPSARFDD
GYNYITIVDGSVPRKEFLSVLLALEDGAHVERESVQYIRTRAYKVMPERHEDLLCVDGEV
FEGPALECQVHRGLGRLITLPRAC
Download sequence
Identical sequences K3WTK5
PYU1_T008299

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]