SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008304 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008304
Domain Number 1 Region: 225-380,425-540
Classification Level Classification E-value
Superfamily NAD kinase/diacylglycerol kinase-like 1.8e-48
Family Diacylglycerol kinase-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008304
Sequence length 543
Comment protein Name="PYU1_T008304" Note="Similar to SPHK2: Sphingosine kinase 2 (Homo sapiens)" AED:0.168067081304898 QI:0|0.25|0.2|0.4|1|1|5|1005|543
Sequence
MQQPSTVTVEEPTSRHAARRMQCRFYQTTRVDFARGLQLSHARGVELHPLSEKPTAVVAP
QTLGKAPRVDVIPWSDILGAAVLTPDQLAHVPGYEPDVNNDKGQEFAIFGCIPKTHVLKR
SAPAFFAFGSKLDALSCFGNAARESEVDDVVRATSVTATSSKPIQSSSSRNAPCERMLVQ
WVFRYVGDDADAVVLHLVHMIQRLADPRIAHSIKPLDDNELPALQRRHQYHAAEIVANVP
LDKYDCIVSVGGDGLLSEIVQGIMKRSDWKQAIQQPLGVIPGGSGNGLSASLLHRSGERL
DALNAAYALAKGSASELDLATVMNGKQDVVYSFLSLEWAFIADVDIESERYRMFGGMRFT
ISSVAKLLARHKRYSGTLRYLSSDFDVPGAPPKYHERLSHQEEGASRPALECLPVVDEKD
SSPSQWREVSGQFHMFWGMNVSHASSDGHIAPNAPIDDGYYYLMLMDGSFSRMSLTKMLL
GLDDGSHIGQKQVQLIRTRAFTLHVDNPADRLCVDGELFDGPEVKVEVHRGLGRVLCLPP
LSR
Download sequence
Identical sequences K3WTL0
PYU1_T008304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]