SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008348 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008348
Domain Number 1 Region: 53-226
Classification Level Classification E-value
Superfamily Bet v1-like 4.67e-33
Family STAR domain 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008348
Sequence length 254
Comment protein Name="PYU1_T008348" Note="Protein of unknown function" AED:0.407160194174757 QI:0|-1|0|1|-1|1|1|0|254
Sequence
MSTEAAAVAVEPKTTLVEGAAAPAASENEYGVPAVPAAYKEMIDSMLARMDKEMNDEAAW
QLHAEKHGIKVFTKVDGALTACKGETFMPFHPRAILDIAIDSTNRKEVDSQLAHGGVLKE
LDAQTVIEYFEYKSMFIVAGRDFCNIAHWRVLPNGTIVIVAKGIEDAELCPLKEPKIVRG
DVHLAAWKIVPNAEYTGAQVFYMAKSDLKGSIPSRVAAKAASDQPYILQRITEALKKKNL
DAAIAKGKVKNLGA
Download sequence
Identical sequences K3WTQ2
PYU1_T008348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]