SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008356 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008356
Domain Number 1 Region: 342-535
Classification Level Classification E-value
Superfamily PRTase-like 0.000000214
Family Phosphoribosyltransferases (PRTases) 0.0077
Further Details:      
 
Domain Number 2 Region: 175-226
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000206
Family Centromere-binding 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008356
Sequence length 537
Comment protein Name="PYU1_T008356" Note="Similar to DDB_G0288537: Putative uncharacterized protein DDB_G0288537 (Dictyostelium discoideum)" AED:0.11531834542987 QI:0|0|0|0.5|1|1|2|0|537
Sequence
MMVGTPTLPTLSSFLRSSSMSTSSMSSSPPRMSLSGSSASLAQLNSTRSATQAAWRHKYP
LRQQQAFPALMVQSMEQHSRKRKQPISSHDPLQQQRPASSFLSSPIGSSLPRVHDTSSVH
QWQQTQQVRTGSNNSFTKTTTNTTTNTNTNSNNATGQHPRLAVAHPLPPVVQRERTSRYL
SEGDRRAIIRRIERGEKQVALAKEYRVSRAAICNLYKNRKEVLTRVDRDPDAKHPKKHKH
KPLAASPEITPSLPTSPVVLSVDEEQHVEEEEEEEGRELKEEEHGLRYQHQEQLKRSSSN
GSESMESDSFRHRSHSPEPRVDRPAAPPKPFHVRDVATHSLPIKNLLRTLRNGDTESPTF
RHTANRLMRMLIEEAVAYVQHSQDNDVDVKMGSPSRDSFPGSGSGSGSGSAVVDERDICA
ITMEEANGASVLLRALTDVLPLASTGAISLTAEDVHSRFPPASHGRRWHIRAQIPERIDP
HQVVLLLDLLCGTGERACSTLQYLVHEKRVAPSSIYFVTVNGSVSGLQNVHHYFPAC
Download sequence
Identical sequences K3WTR0
PYU1_T008356

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]