SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008384 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008384
Domain Number 1 Region: 55-218
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 9.25e-32
Family Dual specificity phosphatase-like 0.0000139
Further Details:      
 
Domain Number 2 Region: 271-358
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.00000000523
Family PLC-like (P variant) 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008384
Sequence length 361
Comment protein Name="PYU1_T008384" Note="Similar to PTEN: Phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase PTEN (Canis familiaris)" AED:0.128035496520733 QI:0|0.6|0.16|1|1|1|6|105|361
Sequence
MAAAMRTSVHEGGGVRVSVTKSRTQPLSMACANGMFALPRALVSQNKLRFRRDGFDLDLC
YLHPRVIVMGYPAVGMEFVYRNPRSEVVRFLEARHEDKYFVYNFCSERERRYPVSVFSDR
AACYPIEDHNVPTFEQLTAFCEHAAAWLNADPDRVVALHCKAGKGRAGMMACMLLVRMQY
ANSAAAAIERYNRVRVRDLRGLTVISQRKWVRYYEQLLLMRPQQSSPTVRPPNEPGFLMT
ELVIRNSLTGVAPPKLLLRVYQLDNASDSKTLRHKAEGYEQFSLREEICGSVLIEFKRLQ
CEGCRTQKHFKIWFNTAFITPDADSGHVVFTRSDMDWVAKDKKKRRIPAAMELEMVVEPN
P
Download sequence
Identical sequences K3WTT8
PYU1_T008384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]