SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008401 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008401
Domain Number 1 Region: 37-149
Classification Level Classification E-value
Superfamily BRCT domain 2.49e-21
Family 53BP1 0.02
Further Details:      
 
Weak hits

Sequence:  PYU1_T008401
Domain Number - Region: 187-256
Classification Level Classification E-value
Superfamily BRCT domain 0.00707
Family BRCT domain 0.05
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008401
Sequence length 406
Comment protein Name="PYU1_T008401" Note="Similar to rhp9: DNA repair protein rhp9 (Schizosaccharomyces pombe)" AED:0.158285558285558 QI:0|0|0|0.57|0.83|0.71|7|0|406
Sequence
MTGLRFDVALVETRRRQQQPVQLQAFYLSPLPSNRAYVSRTKTIFKYKFEFCLTGFMKDG
EVNLTELIEEHGGKIPERYQDVLHKNNPKAVVIATPVSWRKLKFIYAIACGIPVVHPEWI
HACVTAGKVVSFDGYFIPSGYSFTTRKFECLSVQQLDIFAGLSFGIPYDVVRTSNTSTKS
MGSLISFVLKACGAKLVVEDLTPSRDKLVDIVLSNEYTKTCEYYRKKHKTPLRTFPWVTE
CMILQRFIKKSKEDIFQPRVYERDDENQASEEVLAVNAEIGDADRTMLKLHTGELVLADL
SGNGTDHFLLFHVCKILRIIIHREEDDRPRGEEEQSVSLEVGVLKRSSNSPGLSRTHSKI
LQIPTSHVKRRVVAVSAKDFQQLEYRDESIFYYEEKGEQDDNVKAK
Download sequence
Identical sequences K3WTV5
PYU1_T008401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]