SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008408 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008408
Domain Number 1 Region: 31-235
Classification Level Classification E-value
Superfamily Bet v1-like 3.74e-34
Family STAR domain 0.009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008408
Sequence length 239
Comment protein Name="PYU1_T008408" Note="Similar to HOX29: Homeobox-leucine zipper protein HOX29 (Oryza sativa subsp. indica)" AED:0.42688673010838 QI:0|-1|0|1|-1|1|1|0|239
Sequence
MNYFWGESTPAPAAANVKTYKSVDEIDFHAFADETLQILLARHSGDDKVTTWELVDAHEE
GDVKIWQGAVEGSSWSPFRASRRISADKVTIQNSLLDPVLLLKLDDMMDAVNVLKAVDEE
GKLSLRQIVSKGVFPVAAREFVLVTYATALPDGRLVIASRSIPLEGVPLPEGAVRGENIV
TGYIIQETTDANGKPCCDVTLLAHVDLSGYIPATIVNMLGTSSTIKLLDNLEAVVEVQA
Download sequence
Identical sequences K3WTW2
PYU1_T008408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]