SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008409 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008409
Domain Number 1 Region: 32-237
Classification Level Classification E-value
Superfamily Bet v1-like 5.57e-34
Family STAR domain 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008409
Sequence length 238
Comment protein Name="PYU1_T008409" Note="Similar to PA1579: Uncharacterized protein PA1579 (Pseudomonas aeruginosa)" AED:0.387405890921398 QI:0|-1|0|1|-1|1|1|0|238
Sequence
MTFFFGETTPAPAAANVKAYKSIADVDFHAFGEENVQILLNRHSGQDKVTTWQLVDTQTE
GDGKVWKGEVKGSSWSPFRASRRISADKVTIQNALLDPEVLLKLDDMTESMQVLKSVGKD
GEMSLRHMVSKGAFPIAAREFVFITYVTTLPDGRLIIASRSIPLEGVQAVNGTVRATNLI
SGYIIQEAVDANGKPCCDVTLLAHADLSGYIPATVVNMLGTSATVKILANLEAVVKKL
Download sequence
Identical sequences K3WTW3
PYU1_T008409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]