SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008497 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008497
Domain Number 1 Region: 565-711
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 2.74e-16
Family cAMP-binding domain 0.018
Further Details:      
 
Domain Number 2 Region: 947-1043
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.000000000000394
Family FHA domain 0.012
Further Details:      
 
Domain Number 3 Region: 313-404
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000000269
Family FHA domain 0.0069
Further Details:      
 
Domain Number 4 Region: 133-216
Classification Level Classification E-value
Superfamily SMAD/FHA domain 0.0000000029
Family FHA domain 0.0074
Further Details:      
 
Weak hits

Sequence:  PYU1_T008497
Domain Number - Region: 704-840
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.000697
Family cAMP-binding domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008497
Sequence length 1054
Comment protein Name="PYU1_T008497" Note="Similar to odhI: Oxoglutarate dehydrogenase inhibitor (Corynebacterium efficiens)" AED:0.0383886255924171 QI:0|-1|0|1|-1|1|1|0|1054
Sequence
MSSSDNTSLRISSTTSVDARATETTGATTPLHSNKSSKFDFWQRHRSVAPATVSLCAPDE
VNDNSENTTETLLFLNNPSEFDFRSFFRRTSSAEDGATSPVQKEKRRLRAREELCLMVSK
TAHRAKKSWFLSPGFIGRENGEHTLVATKEPSMDPIHAEILVDGDDYLIRDNNSSSGTFL
CLTTINRHHPQRDGFRLRNGDLFWLGINAKVVVHDVCTVPSLTRRADVFQQKLLQLAQHA
VEPDDDEDAESPETPHPESNGSTANKLRHVHFGAVADAADGSSIVGNRYKRKKKKVGNAY
VGQTPVSLNLSLTVRGKEIHKELHLFGKQVYLIGSSPMCDIHVAADGVHPVHARIVFDGF
SFLLQDLSFEENPKRKTRVSLHQPTRIGRGDCLLFGTCVLHVVSVYRAFRDHEPDMKEVA
FKCHMLRPSKRKSRVKEKYIPFGFRHHAQDPFVFGKGRHCEGHIFTAALNVEQFAIQLSH
GSCSLVPRAGGINQGVYFLLGRDCIPHEATYRSDFVRYTSKALMLVEGSVFKCGNTEIEV
VYVKNEAAADVAVRADEVRENALLLGSMPWIQQIAKDRHGIENVAKRGQRLQLQSGDAIY
DEGDPATFLFIVVSGEVELVARRNTFPQSWRLSLVEGYLTSFDSGTESVEPHTEQVATGS
FFGEVCLRGLGLEYSENAKALSDCMLLAISREDICGYFSHYMDIIMPHLEYESHKKLLQK
LRLHVPWLRDLSYQELRILASKAEYATYEQGDAIVENGLFKIDNISRTDGLLLLGYGRAE
LLGKSDPEQPSNDRDTLLQLRIWEPNKPILSIAECPLEGDFYNVRARSRVECYYLDAAHI
SHLVEFGHDGRALLTKEDCIATSGLPRLRRASSNRRSSFATLQQRSRHSQVVLTSAPGAD
DEEHHLENVDMEDLNDPAQKWRRKKRNKNLLEKTILETQQNSDLVNALVMYVLSGANRGD
IHVVRNVATVGGILSDADIELNDRYVSPQQAVIQHREGRFWLYDNSSEWGTFVRLEENQS
IQVYPGDVFNAGEVEFTCLATFPVRKKTQICCIQ
Download sequence
Identical sequences K3WU50
PYU1_T008497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]