SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008519 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008519
Domain Number 1 Region: 343-691
Classification Level Classification E-value
Superfamily FabD/lysophospholipase-like 1.6e-39
Family Lysophospholipase 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008519
Sequence length 722
Comment protein Name="PYU1_T008519" Note="Similar to SPAC1786.01c: Patatin-like phospholipase domain-containing protein SPAC1786.01c (Schizosaccharomyces pombe)" AED:0.131568681992425 QI:0|-1|0|1|-1|1|1|0|722
Sequence
MVMCAEAAMTRTLSVASLVSPQGGRAAWKDTDRIAQFVANVAGGIFVVTGVCGYLINLAA
TSRFELPDVNALLEHALQSVMRKPSFVHPCWSQSNVSDMLMECWSVVHKIHYETGSLAEL
RVFAQVMAAIGLVLVGVFALRKYKWIGWFLCLQFVTILQWFVALYQVVRIALSMSVYFFV
KFTKFVLLSSKRVYVRLFGMKNKYAEALRQLMKAAKTYTEWFHMAKYLDVLEEKENWKNK
IRPEDMDLCDFHQLKANMDNLKRAIAGGNIEELKYITAAFAMRNKLGIDSPGLHLECNSG
TKTVIEEYDALAVRALEILANATPEEFPTAEKQSFFKIIKQSFGSTALCLSGGGAIAMYH
MGVIKALLEADLLPNVISGSSGGSISAAMAACKTNEELLNDILQNNISTRYIPMGIRWFP
PLMEQLAHCVKTGFLVECSAFERTTQHYFGEPMNAEEKIMHYTFQDAYLKTGRHVCITVS
ASDVTGHKGPKKLLLNHINSPHVLLWSAVAVSCSLPGIMKGKQLMARDFEGNIVPYISLG
KEWVDGSIQHDLPMETMASCFNVTNFIVSQVNPHVVPFVGDDVDTPNFRKSMFHTLESVI
AADVRHRLKMLAFLGLFPKIYGHQFSSYFKQNFSGNVTLIPDFIFLEAIGIKAILNPTVD
DMNRYIEGGQRCVWPKLQYIRHLCTIEKALDKILAELLGNEVVPYCNWLQPTTKVDPETI
VL
Download sequence
Identical sequences K3WU72
PYU1_T008519

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]