SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008541 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008541
Domain Number 1 Region: 117-174
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000215
Family Centromere-binding 0.0051
Further Details:      
 
Domain Number 2 Region: 253-302
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000995
Family SAM (sterile alpha motif) domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008541
Sequence length 425
Comment protein Name="PYU1_T008541" Note="Similar to CENPB: Major centromere autoantigen B (Homo sapiens)" AED:0.040168324407039 QI:0|1|0.66|1|1|1|3|29|425
Sequence
MRSGRPRVRGNGRRPRKPVDDAPSADTAVDETGVIQRTSVDYRHKLTVIEYFLAHGRDAS
ATVEHFYPDATKDMRRTKMKLLSAWLKQHDKIRERCESGLAHQRNVRHQGQGATLSREME
AQIVEWMHAQHRTGVKVTAKMLQQKARAVAAECGLGEDVFTASWSWRDGFLRRHFRSPHA
APAKHIPHSEQRETTPQKSSDSGAEQDVEREPDIDMEDDEDTEEEGSTAGEEKATEKSGE
DQDIAQETVAPKEDLASVLHQHGLSQYLEVLQENGFETPASLAGIDEYFKDLGVKLGHRK
LFKDVSIRYTPGMEARVPFAKVVIDIQAHFEWNKKCKFMAKSICQQWPKNVSVEVQNLFY
GRIHASADSSIGYSYKETELSAGEPRRCKGEIVFSATLRDLYEAGYDTKDWKPFHHRLTL
DKSDQ
Download sequence
Identical sequences K3WU94
PYU1_T008541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]