SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008561 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008561
Domain Number 1 Region: 544-682,712-796,849-926
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.6e-70
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.0000367
Further Details:      
 
Weak hits

Sequence:  PYU1_T008561
Domain Number - Region: 142-262,291-443
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0485
Family Rhodopsin-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008561
Sequence length 948
Comment protein Name="PYU1_T008561" Note="Similar to PIP5K6: Phosphatidylinositol-4-phosphate 5-kinase 6 (Arabidopsis thaliana)" AED:1 QI:0|0|0|0|1|1|3|0|948
Sequence
MSRLLQQKRPSLLLPRDSDPIRRDKEYATFCSISLTSDPRGSKSLTDEIAAFHEQIRLQK
SQQQQQLRWMKRRLTEQSSRVGRGRRKSGGQSACTSLCFCCPCIPRIPLFIGLAGSLFLL
GVAGVAFSVWSLAKASLDTDQVLFLGALVSLLFSLVVVICYAKSEIVRAHPNPLIFSKSF
VDLLLAGLYIFQYCATEYASSRVVLPFRIAALTQALLVCGEFWFFAIPIDLVQSITNPFT
SYAYNFRVYWLYSTLSGTVCGFILWFLNDDNDGCANPEDCRLSGKEDQRFFWFHHNTDMP
GFFWHRWILYHLWVLVYLVFGFFCIWFVKRRLRRGLEETFDVRSRILKNGIFTCAIYISW
SFAILCLFALTNVTTTKHYLKTSAFGMLINVSAFLHAARGCVNIIVWLVVNAPYVSSMSA
RRKRSLSKLSSLSSPSDTSAMSLSLDGDEQDGLLNPQLNTALRKQMIHMATSGIIESVEH
YHIMSKRIHSNQTFNLDWEHSKQRDLLKMSSSLSVNRATAKRNSVIQVVEARDKTSTPRF
SFLPVAMKEMQFYDFQPRVFASIRLLYGIDDGEYMFAFRSTINERISEGRSGAFVFNTCD
RKYLVKSMTSEEKSVLLELLPSYLRYLKWNPNTLLPRFLGFHAMKMYGQIFYFVVMGNIL
STPEPIHRRYDIKGSWVDRNAPACVLGEKYRCSKCNRFFTFGATDGSSVPCDAMGSDHYP
DITLRDNDLKKRLKLEPETASKLLKQLTRDSNFLASMGIMDYSLLIGTHYSHFKITTKPK
KQQARQPQEKNPPELERGTPTQFGTDGKEFVHVLVDKPCERQGGDDEITEDEEVEEVGPP
ESYVGEQSRSNSGGFQAHSHCYRAHQVSGPSAYYFGLVDILQQWTLGKQAERVYKVQVLR
KNGRGVSAMAPKPYAHRFQQKMRQLFSSSQQVFESKQQQQFDDADSRV
Download sequence
Identical sequences K3WUB4
PYU1_T008561

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]