SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008601 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008601
Domain Number 1 Region: 17-299
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 4.25e-27
Family Sir2 family of transcriptional regulators 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008601
Sequence length 331
Comment protein Name="PYU1_T008601" Note="Similar to npdA2: NAD-dependent deacetylase 2 (Thermoanaerobacter tengcongensis)" AED:0.197545677214352 QI:0|0.33|0.2|0.4|0.77|0.7|10|0|331
Sequence
MDAPAAAAPDVRALWRDAAEKIAAADFLLVAVGAGFSADSGLPVYKDIASMQAYEEMGVD
YRDLCDPYWLEEDDQVFYGFWGSCFNAYRDTKQHDGYDILRKWKQHLRPSSVVVPFRKLT
HTTPIACTVRQVDAHFLRDFKRNEVYELHGNVERWQCAGAVGHAVVLREPCDEQWDASAE
FRFAVDAKTMRAEGNDALTTCAQCGGKGRPNVLMFHDKMWIPNLDHEDRYIAWEAVVEEM
LEENPSLKLVVLEIGCGTRVPSVRRECEMVVGDIFERCGRAQASLVRINPDFPHCDNDAL
TTNGLVLSVPSKGLEALEAIDELLSQIKAAK
Download sequence
Identical sequences K3WUF4
PYU1_T008601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]