SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008640 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008640
Domain Number 1 Region: 352-421
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000197
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.0026
Further Details:      
 
Weak hits

Sequence:  PYU1_T008640
Domain Number - Region: 715-881
Classification Level Classification E-value
Superfamily GAF domain-like 0.00216
Family GAF domain 0.041
Further Details:      
 
Domain Number - Region: 127-275
Classification Level Classification E-value
Superfamily Bet v1-like 0.0111
Family STAR domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008640
Sequence length 1006
Comment protein Name="PYU1_T008640" Note="Similar to FGD4: FYVE, RhoGEF and PH domain-containing protein 4 (Homo sapiens)" AED:0.226258814199881 QI:0|0|0|1|1|0.5|2|0|1006
Sequence
MARKEQTVYLTRAKSYLPQLIAECARDDSKVSDTSGNGPEVRPVSGSITNSSIPSVWKGV
KSKKKSTNVQVWEKESVQGLGPEFNTATLVNRTDHSNNNYANNDPWTTTASTFTAGVLPL
GTHHVAHMYAVRSSVTVPAPLDVVLKVLDCSAVSAYRSFTKIIYESLIGETSVLFHSHSA
SSSSSSGSSSASSLYAPSESLAARWLTCRCNNPMVSDCDFCLLDAYKILYSIETKSCPEL
FDMHRIARCNVPLGGFLFYPTENSEVTDVVFYMAVTQDRMAMSAATSATTNSAPIQNNSS
NNPFSAASSNDRQFRAVQKVLQHMARGIGRIRNAVDAYSMSLRLEILRDNSRWVRNTDRA
ECVVCYRRFHQLTRRRHHCRMCGDVICRDCSVYKDADLPNVGPTLVRICKLCELNELKHV
SINSDSVVPSATTTAEPTTTATTAADAAPRPLARKRSATINVDTSKAIVHEHEQQPDVGR
RFTTVVDGKQRRELSEHAFNTPKADIMDRKHKWNTGGGGKPLAILSPSFATHRPGKAAFA
PKSMTPKARSHAPQVWDLDSAAIAAASREIGEASSSSSSSSSAAAQPPMSKLSKKQPHAQ
ANSCSKLASKNDRFTFTFRRKKSRQEENNYDDEEEEKSAVVVPTSALPGRPSRAIKSGKM
VSPMHDGLISSNGRQRAVSIKNKRNNQQQNDDGEIGGVAAHKLMPRKLPNVHQYEDILLT
LCEQVSNLLNCKYAAVSIFTAPPSARVPTRAQQPVGGIASPASHENYTMVHFLKAEGSKK
LGKVSANMKCCAPMLELKDKIIVRDTLAECNLFDFKKLPIVMGPQQVRFYAGIPLVDPMT
HQMVGAFAVFNSNVYRRSNLNEVLPTLETFAAVALDAIEDRKTDLELQSFLQNPLVDAKT
LDNQSALRLSEPVLQVDKFLSENGDGAIEYDREKGSDDGRFRTTGHMELAVRPRFSTRPP
SVKKRPEHGTIEFYKRQMEKLVRQARDTEAQVLENSMAMKRHGVVI
Download sequence
Identical sequences K3WUJ3
PYU1_T008640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]