SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008652 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T008652
Domain Number - Region: 58-91
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000385
Family Synaptotagmin-like (S variant) 0.046
Further Details:      
 
Domain Number - Region: 277-335
Classification Level Classification E-value
Superfamily Ribosome recycling factor, RRF 0.0659
Family Ribosome recycling factor, RRF 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008652
Sequence length 558
Comment protein Name="PYU1_T008652" Note="Similar to UVRAG: UV radiation resistance-associated gene protein (Homo sapiens)" AED:0.0789738130594768 QI:0|0.5|0|1|1|0.66|3|0|558
Sequence
MSSVRGAAQFGWQTPSSAPLASFAPPPSSSSSSSGWKNTATLQQLTGFGMRNLSVYGATI
GMLMDVYFKLVVDRQVVYVSEVACDTLNPVWVPFQSDDNPLGDGSMRHLFTGTYFDIIVV
RVKDRKRLRRKSRALSGRIVMDDDAWEPNARSFAEDSGDEDDEIRGETNGGVLEEEILGM
SFNVRELEPLPVPVSDITNLPLNTCLFEINGRTYVKREVNEVLLDSGVISMKHSRRKGSA
IQLKEYSLHHGVDNLEAVLLTKQKIENMTEHNENLKKQIEQKLVVAKPQVSKEQKRTMME
ERVRALRQQVAEKKQNLERSKTLMQDERKIFETDIHIPKALLSTMQMSMKYKDEKQSILE
RRCEVLRAAHKIRSRQAMLVKQLGAVYPIEYEGVGEYKIRGIKILNSDLTAAGRAEEDTI
STALGYIAHLVFMLSKYLQVNLRYRVVPYSSRSYLKDEINDPHGEYPLYKKGSDRERYEK
AIYFLRKNVEQLLFSRGLDPTVGSPILARLKALTDSEAAWLLSNRDFHASMSHSSNHSPS
DATAAANGTIVPQQRGPP
Download sequence
Identical sequences K3WUK5
PYU1_T008652

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]