SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008675 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008675
Domain Number 1 Region: 168-222
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000117
Family Myb/SANT domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008675
Sequence length 552
Comment protein Name="PYU1_T008675" Note="Similar to TPRXL: Putative protein TPRXL (Homo sapiens)" AED:0.13381555153707 QI:0|-1|0|1|-1|1|1|0|552
Sequence
MPVIPSVMMMKVSEPSRATRAAAASGLSLQHGLRVTPESAAMLHAAPVTPSDASASSAKN
VSMASSSPAAVFSPRDPSAKVAAVNPPSFSSKIAAPPSSGYGTPSNQVVSSISIKHPTIQ
PPAAPSTPRMADSAPSSPESSPVGKRGQAAVSTPKTSSSSASSPKSTKANTGRWTDAEHK
LFLKGLEAFPYRAWKKIATLIKTRTVVQIRTHAQKYYQKLEKEEARMKDREHHHDRATHS
HGYNDRSSHKESSLLSSSASSSSLCSHTSDASDYSDESSFTPKSSNSPAKKKTMLRKRKF
TMDEDSPASGASTPVASAVTTLPSLPKRMMKEKKFPREKHMSPKQKAPVSGNKFFGSSFS
SPEFGPETTPRAVFGRGNSAASKIPPHPLDFDDDATSEHMILDFADDKSIVEYPFHLDGS
IDHGISSMDNDDLLQLTDEESLDWFSTTTSGNDHEELLKAEPLGLLTAESTEECAADTSD
SSPLTLGRYHFSPLYTDECLQFSDESNGSSPSSVMLDSCDASDFILSGDEDDDFVLDPEK
FLSSYFSPASIN
Download sequence
Identical sequences K3WUM8
PYU1_T008675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]