SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008707 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008707
Domain Number 1 Region: 6-58
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000841
Family Ribosomal protein L24e 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008707
Sequence length 151
Comment protein Name="PYU1_T008707" Note="Similar to rpl24a: 60S ribosomal protein L24-A (Schizosaccharomyces pombe)" AED:0.191456216188887 QI:0|0.5|0|0.66|1|1|3|0|151
Sequence
MVIKTETCSFSEGRIYPGHGSRYIRRDGSSYVFINSKSKSLFLQRKKPTKIVWTLGWRRM
NKKLKVEEVSRRRVRKTTKIQRAIVGVSADDIRKKRNQKPEVRAAARAALAEAKDRSKAK
KAANKAEVAKKGGKSAAAPRAQKKTGNRGAL
Download sequence
Identical sequences K3WUR0
PYU1_T008707

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]