SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008717 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008717
Domain Number 1 Region: 44-243
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 0.00000000000000576
Family mRNA capping enzyme 0.002
Further Details:      
 
Domain Number 2 Region: 270-309,339-384
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000248
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.026
Further Details:      
 
Weak hits

Sequence:  PYU1_T008717
Domain Number - Region: 428-453
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00204
Family CCCH zinc finger 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008717
Sequence length 602
Comment protein Name="PYU1_T008717" Note="Similar to ceg1: mRNA-capping enzyme subunit alpha (Schizosaccharomyces pombe)" AED:0.0223210322406525 QI:0|0.85|0.5|1|1|1|8|0|602
Sequence
MAGSTGVTHIAGVPVDIGQPVHVTSKKQLQRQINGIVNWNELDRAPMSIGQTLLRSNEPQ
IAEHPYFVCEKSVGIRYLVLLLQGRCYLISPNYDIREVVLFSPVRPDRLQPGVDRNTIVP
HQWTILDGLLVCDKDGPKSVLTLLLYDILALNGSPVMVSKLQDRLKLIQNDVIGPRKTIP
PPKNQPPDPFQLVLQAMYPVNRVSHVIRTIIPRVSQTRQNAGLVFTPVILPYTPGYAKGL
YHWSPTSQLIAEFQLGVEWRGRPPKPGFKLIIHEKRTQVFHDWITFSPEDFDTFRQDKKA
SSRIIECVYDPEWLTFVPSHDKSTWEIGNPELNATERGQGWRKGGWKYVRSRPDKLMPLE
RGYLGMVEKAIGEDIKLEEFENLFPDDPSKKTSLMQKLRQDAPPVQDDYAPPSKKKRGSG
GGPGGGAGPGTGVCYDFQNKGVCQRGRFCHFSHCACNSTCSCTTTKNTYGQRPSYRRNDY
DAPPSPETTPAADPSAVPEKLPALRHADSFEREKALKSDAGAEEEEAGELSDNGNLHIGS
IYTPLESFDKDSIAAKRAQLSALGNRRIWASLGLEDKLQRTRVCGLIVSKTGDVTYVRPM
DK
Download sequence
Identical sequences K3WUS0
PYU1_T008717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]