SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008722 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008722
Domain Number 1 Region: 57-169,295-397,794-909
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 2.09e-97
Family Calcium ATPase, transmembrane domain M 0.00014
Further Details:      
 
Domain Number 2 Region: 401-421,581-846
Classification Level Classification E-value
Superfamily HAD-like 3.54e-56
Family Meta-cation ATPase, catalytic domain P 0.0000983
Further Details:      
 
Domain Number 3 Region: 409-645
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 1.05e-45
Family Metal cation-transporting ATPase, ATP-binding domain N 0.0012
Further Details:      
 
Domain Number 4 Region: 168-277
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.88e-26
Family Calcium ATPase, transduction domain A 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008722
Sequence length 960
Comment protein Name="PYU1_T008722" Note="Similar to pacL: Probable calcium-transporting ATPase (Synechococcus elongatus (strain PCC 7942))" AED:0.0765276145710928 QI:0|-1|0|1|-1|1|1|0|960
Sequence
MAFSYQGSHTPKLPDGELDRDSHRSRFLSEPEKILVDNPAKTRQSYRVLDSVTTQAGWHD
QAIEAVLQQLEVDVQSGLTDQEAQRRLAQYGPNALEGDKRAPIWVIFLLQFFNLIIGLLM
LAATASIALQEYVEGLAIIAIVTLNAVIATMQENRAGNALEALAKMSSPQCIVVRNGRQV
QIASDALVPGDIVMLTTGDIVPADIRLITSSDCKVNEMILTGESEDVYKKFDANMSTSTK
LTSDNMVFASTSIACGNATGVVVETAMGTRVGSIAALLRDKKSAEGGNCCSRFLDKYQTK
MTPLQEALHHLGVFMGSAVLIICAIVFIVGMVRGNHDPKNADRPVWLTMVMVAVSLAVSA
VPEGLPMVVTICLSTGTSDMVKKNVLVRKLAAVESLGAASVICTDKTGTLTEGKMTAIKV
WGDFCECMVSGTGFDPTGDFLLNGIKQTPENNTQLHTMLLSAVLCSNTTLQQEKNDDGML
VWTPMGNASEAPLVVAAAKMGIWEADLSPQYPRLTEIPFNSSRKMMITLNQVSNGRLGNL
VLPQGVTYVANVKGAPNYILKNCQQYVRKAGDIVDLSNKNRAAILEAVDELSSQALRVLA
IAINPLTNLTFAIDSDDIDDKFAQLCTPLIFVGLVASIDPPRHGVKESIKIARAASIRTM
MITGDYLKTAVAIAKSIDLLSVGADVDEEAVDCTILRPRGDEYLTDHDLDEITSRTSVFA
RAKPEDKIEIVKSLQRQGHVAAMTGDGVNDAPALKEADIGVAMGISGTEVAKSASDMILT
DDNFCSIVAAVEKGRVIYTNIQKFVCFLLSTNFGEISIIFIAIAVGMPNPLEPLQILVLN
LFADGMAAVALSLEKGDPKAMSERPRPKTQQIIHGRLWVLVMTNAFLIGAGALIVFSAGL
YWNFQNVLMDDILGSAKTVEDYKSVRCYHWQGVKDHWKTFGNCDALSSTARAFSQYCRVG
Download sequence
Identical sequences K3WUS5
PYU1_T008722

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]