SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008804 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008804
Domain Number 1 Region: 303-512
Classification Level Classification E-value
Superfamily PRTase-like 9e-30
Family Phosphoribosyltransferases (PRTases) 0.0000783
Further Details:      
 
Weak hits

Sequence:  PYU1_T008804
Domain Number - Region: 206-257
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000564
Family Centromere-binding 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008804
Sequence length 527
Comment protein Name="PYU1_T008804" Note="Similar to uprt: Uracil phosphoribosyltransferase (Toxoplasma gondii)" AED:0.15625 QI:0|0|0|0.66|0.5|0.66|3|0|527
Sequence
MNSNSTGRAPSNPHHHTPPQRRLPVFPYQRPLQQQHLRTFPPRSHSAPDGDLSARGIDNS
ELHQHNHHSHSLNDIDDLDHELAYPLSALTTPSTIRSSRHTDHTPPASSRESLLAFLQDR
GSPEFELGKEFVRGSSSRKNSDEEISSRTSSVGTANSVSQQQLDHIMEDTSYSQNGRAQQ
QQQLRKSSNRTQAVVNVAGGAAGKRSRYLREVDRRSIIHRIDRGEKQAALAKEFGVTRAA
ICHINKNRIEILTRSTRADVHSAARHPKRGLYTTSVAPPSVIQALAAREQAEADAASDAQ
PIVHEMKSRSMAVLMTTLRKRETQPRDFQICTDRAFRLLLEEALSRVPMHAVDIVTPYDF
VCEGVAMDRPSCGISISEDGFALLQIFRDVQPASPVGFITLNATAMVDGQSAEPTLQKVC
APPDLRIYNVVLMEATCATGAGACVSIQALLDFGALESSIHFVCLLASAFAVTEICNRFP
QVRIVTGGIDPDVSEGDAICPGIGNFTERYFNTTVTHHTSMGANVDL
Download sequence
Identical sequences K3WV07
PYU1_T008804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]