SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008805 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008805
Domain Number 1 Region: 5-59
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000353
Family RING finger domain, C3HC4 0.0024
Further Details:      
 
Domain Number 2 Region: 99-159
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000752
Family Canonical RBD 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008805
Sequence length 161
Comment protein Name="PYU1_T008805" Note="Similar to NOT4: General negative regulator of transcription subunit 4 (Saccharomyces cerevisiae)" AED:0.372774869109948 QI:0|0.25|0.2|1|1|1|5|0|161
Sequence
MADEEEQDCCPLCMEELDITDKTFDACPCGYQIKNEYNGLCPACRTPYSEISKQKNTLDR
EDVVRRTKQRKQKEKSDRRNAAQSNKQTINRKNLANILRSLDCFGQYGKIIKAVVNKSHL
STDRSNATASAYITFSNKEDALACIIAIDGYYLDGSLLRPG
Download sequence
Identical sequences K3WV08
PYU1_T008805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]