SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008809 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008809
Domain Number 1 Region: 9-116,226-322,792-1040
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 1.57e-87
Family Calcium ATPase, transmembrane domain M 0.00077
Further Details:      
 
Domain Number 2 Region: 326-346,561-825
Classification Level Classification E-value
Superfamily HAD-like 2.27e-52
Family Meta-cation ATPase, catalytic domain P 0.00018
Further Details:      
 
Domain Number 3 Region: 334-394,452-623
Classification Level Classification E-value
Superfamily Metal cation-transporting ATPase, ATP-binding domain N 4.58e-35
Family Metal cation-transporting ATPase, ATP-binding domain N 0.00011
Further Details:      
 
Domain Number 4 Region: 115-224
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.09e-21
Family Calcium ATPase, transduction domain A 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008809
Sequence length 1064
Comment protein Name="PYU1_T008809" Note="Similar to ATP1A1: Sodium/potassium-transporting ATPase subunit alpha-1 (Equus caballus)" AED:0.0263618953042986 QI:0|0|0|0.5|1|0.5|2|0|1064
Sequence
MSGPLASQSKLTLSQGISSDQVPVIRQVCGFNRLSPPGRIPDYILFAQQFLDWFMILLNL
AGLLSLLAYLLDTSVAINLYLAIVLFLIVPFTCIMTFLQARSTSRVMDSFNSMLPQQCTV
VRDGATQLLPAEELVVGDLVWIRNGDKVPADLRIVLCSNLKVENSSLTRESELIALPNDA
QSASVPGLECTNVAFNESLCYDGSALGVVLSIGDQTVIGRVAKLASSTVQRETNMQREVK
SFVQFISFLAISMAGVLFTIDVIRMDGHDALKTFVNGFLVIIVANVPQGLPSTVTSLLTI
TAKRMATHSIFVKRLDCVETMGSLTLIATDKTGTLTKNVLTVTDTWVGGAFHHQPTVDNP
TLDVDDNLDYLTSNAATAVLFRNAALCNRAKPEPRDLDSVLDASSVLRAFATRPSISEAD
VAVAAASPVPDLRSLRLSNTGAGTGAPYRVRRDFVLHRKYTGNLPDVTRLRVADLQFSVK
TTREHFPVLFEIPFNSANRWHLVIVPSPPSEAVSNTTTTATTHRHSVMDVLVKGAPEAVI
RRCSTYLLPTGEEDAMDQNFHDKFKQAYELFGSHGRRVIAMATRRFTPASANVVFSADNR
NFPTDELCFVGMIVIIDPPRDDVPEAIQMCRDAGVKVFMVTWDHPLTAQEIAREISLLHE
HDNVLSLLMSPGGRFEKEKEVEEDWSEYDAAVVHGAVIDELTPDQFNAVLRMRQVVFART
TPEHKLGIVRASQALGECVGVTGDGVNDAPVLKQGDIGVAMGKNGSDVVREAADIILMDD
NFSSIVRGIEQGRTIYDNLKKTIAYTLTHLWPEVALVALNLAFGMPAALTSLQILSVDLA
TELEPAISLAYEEPENDIMSRPPRDMNRDRLMSMPLLQYVYMVAGMVNVCGCFLAYATVF
WRNGISLSEMYMSSDTFWKGDAPAFCTNDGSRCFTAQEQTDPLAKACGSRYIALIGCQFF
HVWMCKTRRVSIVKHGLFNNTVMIYGTLLVLTLAVCLTYVSALQDIMSSASADYIPWLIA
LRTGSITWLYREGTKSIARRDELDPATKGFVTKYLTYGDVYPTL
Download sequence
Identical sequences K3WV12
PYU1_T008809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]