SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008836 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008836
Domain Number 1 Region: 38-181
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 5.46e-16
Family Synaptotagmin-like (S variant) 0.026
Further Details:      
 
Weak hits

Sequence:  PYU1_T008836
Domain Number - Region: 274-360
Classification Level Classification E-value
Superfamily E set domains 0.00369
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.05
Further Details:      
 
Domain Number - Region: 499-544
Classification Level Classification E-value
Superfamily E set domains 0.0728
Family Other IPT/TIG domains 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008836
Sequence length 557
Comment protein Name="PYU1_T008836" Note="Protein of unknown function" AED:0.452054795664194 QI:0|0|0|0.33|1|1|3|0|557
Sequence
MAIASSPGTPPPSSPSKHEFGSALANPLMKIWNREPGLYVAVLRARNLQVVKKHTCNPFV
VISCNNKVRLKSTRREGTMAPVWNELFDFEWKSPSVSAGLSLPVLRVVVENQLTMDQSEI
VGNVEIHFAGGDTSANHAFSLRAWFPLRKIISKAALQNDHQQHQSSLSLGDIELAVSFIP
PPPSSAKSDNGNGLSSKLSSTLTLKSSVLSLITRKKQQHQPVEEVLKKKKEKILSRLFHH
QSPTASMVPNELSVELALNGQDFWSVAPHRCYLTPTPILVRVEPTYIAISGGTQVHVFGM
NFTPTSILRVAFAFVSVASGTVAMPWSLVSHIPTIDVTRIVVVDAKYRSSTCISCVAPSL
LSIATTDAKNNNTDVVVVYVSTNGLDFESIGLPHRHTTVQINGEQDVMDEERVERDITRN
SIPRKRNEDVIVLENERYLVHHDRLAIVGVAPTVSSSSCSKKGGPNRGALEESKNSDHTA
DARSFTFPLMQHVHLYLIPIIDGVRPSDGIYTSQLTIEGHDFTQTNVATARFCAKADAND
VLSDWNVHFRISRVARQ
Download sequence
Identical sequences K3WV39
PYU1_T008836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]