SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008841 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008841
Domain Number 1 Region: 1-88
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.57e-19
Family Ubiquitin-related 0.001
Further Details:      
 
Domain Number 2 Region: 487-530
Classification Level Classification E-value
Superfamily UBA-like 0.0000000000000389
Family UBA domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008841
Sequence length 532
Comment protein Name="PYU1_T008841" Note="Similar to Ubqln2: Ubiquilin-2 (Mus musculus)" AED:0.162001218545096 QI:0|0.33|0|0.5|1|1|4|0|532
Sequence
MVTLHVKTTAGKKFSVDVALEGTVVQCKQALVEPTEVPEAQQRLIYKGKVLKDDQTLASY
GIEADHTIFFVRGSAPRPARPAPTTEASSTSETPAPASSATPAAVPTPAAAANPFGFPLF
PPMGGATAGANNGAAANSFGGLFGAGAGMPNMATMQQQLMQNPDMMRQMMESPMMQGIMN
NPEIMRAMMQSNPQIQQLMEQNPQLSHVLNDPELLRQSMEAMRNPAAMREMMRSQDTAMR
NIESHPEGFNALRRMYHDVQEPLLDAAASGANAPRGPAFTMPGVAGGSANATTTQPASTA
NLTASSTTTSANPWATPSTSQNTSAAANPWAGLGGFGGMNAGAMGGAPNPEMMAQILQNP
LFQPALEQIANNPELFLSQMEQMNPQMSQMLNANPQVRQMMQNPDFLRAMMNPQNMQAMM
QMQSAMNQLRQSGLVPGLEGMNLGGATAGGSAAGASTGAAANPFAAFGGFGGFPLGGAAP
AAPVGNPEELYASQLTQLVDMGFSNREQNIRALQATQGNVHAAVDRLLSGTI
Download sequence
Identical sequences K3WV44
PYU1_T008841

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]