SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008873 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008873
Domain Number 1 Region: 136-238
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000159
Family Fibronectin type III 0.0029
Further Details:      
 
Weak hits

Sequence:  PYU1_T008873
Domain Number - Region: 35-77
Classification Level Classification E-value
Superfamily MoeA C-terminal domain-like 0.0894
Family MoeA C-terminal domain-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008873
Sequence length 245
Comment protein Name="PYU1_T008873" Note="Protein of unknown function" AED:0.192189520679401 QI:0|-1|0|1|-1|1|1|0|245
Sequence
MYSHPVLVRWLLMNGADRSTPCYLKQTALDFVGECCEHTSVVAVNQGSDLLSASAECRAL
LQEPASLPFPPGERVVVSSSHSSEVVFLRSPAATPLAAIRGLPPGNSSGDLTQRKNTLPS
SSKASSLQQKIFKCLVTITWETPLSNGAIIDKYEIRYRSIVDDDDSDELVGLTGDAEGGS
SHSESWRLERTNHNRKSREQNVTVAGLQFGTLYEFMIRSWNAAGKGEWGRSYKVKTREPP
DLSTS
Download sequence
Identical sequences K3WV76
PYU1_T008873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]