SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008875 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  PYU1_T008875
Domain Number - Region: 34-82
Classification Level Classification E-value
Superfamily THUMP domain-like 0.0628
Family Minimal THUMP 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008875
Sequence length 150
Comment protein Name="PYU1_T008875" Note="Protein of unknown function" AED:0.597319670664042 QI:0|0|0|0.66|1|0.66|3|0|150
Sequence
MSAAFHVEFWESTPTTTHQTILQMALDLLVCWIEDHTPFETGQTIATLFGYVFALYSAYS
VQLGTPKHKIDIDPRSWTALMGIEFVAAGLGAALFPQAAKQVLRMLHTLAVKENAFLKCL
RGFGHQFRVKSGRVHRDDARSIADAYKANT
Download sequence
Identical sequences K3WV78
PYU1_T008875

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]