SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008886 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008886
Domain Number 1 Region: 27-139
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 8.73e-22
Family PLC-like (P variant) 0.063
Further Details:      
 
Domain Number 2 Region: 175-298
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 3.27e-17
Family Synaptotagmin-like (S variant) 0.054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008886
Sequence length 376
Comment protein Name="PYU1_T008886" Note="Similar to TCB1: Tricalbin-1 (Saccharomyces cerevisiae)" AED:0.0744609749690714 QI:0|0.8|0.66|1|1|1|6|195|376
Sequence
MHSRGASSVRSSMSGMSGQTVALRNDCVLFLTVVGARDLKNTQKLGVQDPYCVVYLISEG
KASAEPAFKTSTHDNGGTEPQWNEKGTILIPNVSTDILKVKVRNENWVGSNTIGKILIPL
KDLSRGRSMEKEFVLLPQGFVKILMYLSIGHENPTSQPRMKFGEYPQHFIIGKSKLFLGL
ISGEKLRDIQSFGTQDPYCEVFISKRRNPSAHDLVYKSKTHNNGGKNPRWMEAITVGVRC
IEHDFLVIRVMNDNHLKDDLIGEMCLKLEVLVGKGFEDKNYPVEALDTIVGQVRLQLALF
NDEVLDDDESDHDGDLDGCSCSNKMVMRATKVGDVLINGISPDGVQYLEAGTVVHTGCEL
AGDYVMDKFYWEGDEI
Download sequence
Identical sequences K3WV88
PYU1_T008886

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]