SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for PYU1_T008892 from Pythium ultimum v1.7-2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  PYU1_T008892
Domain Number 1 Region: 7-67,109-209
Classification Level Classification E-value
Superfamily Tubulin nucleotide-binding domain-like 0.000000000641
Family Tubulin, GTPase domain 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) PYU1_T008892
Sequence length 499
Comment protein Name="PYU1_T008892" Note="Similar to DML1: Protein DML1 (Coccidioides immitis)" AED:0.103333333333333 QI:0|0|0|0.25|1|1|4|0|499
Sequence
MSGNVEETLRLQFGTAANTISTQWLELHARESQDPRLMRADGSPRLIAFEAKDRVQKRRV
AANATKRPRVADIQEQAAWTGNVQVYDQSEAEPVDSASNDNGLWNWSRLHANNLFEVDEF
RAHMPLHNFYEGYAVSKDGSISNSTFEAAEERIRGVLEECDRLRFVQTLVDMDSSWGGFA
HEILTYVSEECPSAVVVTFANDWTYPLADQSIESVFALTPDNRDKVKNEARKRINIASAL
GLLSEVSTLLVPIAMSDVSLPRASRFAHLHGVSSESCAQMGTIAATAIDLALSAYRHKSV
YEVVEGVVPSRKIMELAARFPFEGNPVELLDAISNQSEVSTPQDDPLANASLLPAIPERA
ALRSRYEEDQDDDDEASSTDGKVFYRRFHLRGSFPDYSSSLYDSIQRVRSTKCVVQWTSD
ARVELSSSYRIPALAGARVDAVSQLSTSSRIGAYVDHVTQLLESADKRVLYEFTRSGMNP
DAVEDLHAALGGISDAYQE
Download sequence
Identical sequences K3WV94
PYU1_T008892

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]